PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 275aa    MW: 29526 Da    PI: 6.6404
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009176.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.3e-072252582154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  Do009176.1 225 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 258
                 469*****************************87 PP

2ELK28.33.9e-10179200122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++L+++Y+++L+++++E++
  Do009176.1 179 ELKNELKQGYKEKLVDIREEIM 200
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-194387IPR005540KNOX1
PfamPF037901.2E-164683IPR005540KNOX1
PROSITE profilePS5121310.057179199IPR005539ELK domain
PfamPF037895.9E-7179200IPR005539ELK domain
SMARTSM011886.3E-4179200IPR005539ELK domain
PROSITE profilePS5007111.515199262IPR001356Homeobox domain
SuperFamilySSF466895.56E-16201264IPR009057Homeodomain-like
SMARTSM003893.4E-10201266IPR001356Homeobox domain
CDDcd000868.21E-12202263No hitNo description
Gene3DG3DSA:1.10.10.609.0E-25206263IPR009057Homeodomain-like
PfamPF059207.2E-18219258IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MSFHYPDHGL SMDAAAAAAA AAAAAASSPN PSGFSSPGVV GGEREKAAIA AHPLYERLLE  60
AHVACLRVAT PVDQLPRIDA QIAARPPPLA AAAGAAAAGG PSGGEELDLF MATLSHSRIG  120
YAGASPGEGT GATMSDDEDN QVDSEANMFD GNEGSDSMGF GPLILTEGER SLVERVRQEL  180
KNELKQGYKE KLVDIREEIM RKRRAGKLPG DTASILKAWW QAHSKWPYPT EDDKARLVQE  240
TGLQLKQINN WFINQRKRNW HSNPTSSGEK TKKKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12202266872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1255274RKRNWHSNPTSSGEKTKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0685100.0BT068510.1 Zea mays full-length cDNA clone ZM_BFb0231A20 mRNA, complete cds.
GenBankBT0836590.0BT083659.1 Zea mays full-length cDNA clone ZM_BFb0026A02 mRNA, complete cds.
GenBankHQ8587490.0HQ858749.1 Zea mays clone UT1455 ORPHAN transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451671.11e-157hypothetical protein SORBIDRAFT_04g005620
SwissprotQ0E3C31e-147KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLC5XWW91e-157C5XWW9_SORBI; Putative uncharacterized protein Sb04g005620
STRINGSb04g005620.11e-157(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-108KNOTTED1-like homeobox gene 3